PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_140280_ckch.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 169aa    MW: 20087.5 Da    PI: 6.5159
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_140280_ckch.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.4e-1476134563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         ++ rr+ +NRe+ArrsR RKk +i eL   v  L +eN+aL+++le+ ++   ++ +e+
  Bv6_140280_ckch.t1  76 RKHRRMLSNRESARRSRMRKKRQINELWSHVLRLRTENHALIDKLEHVSESHNQVLQEN 134
                         689**********************************************9999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-1166128No hitNo description
SMARTSM003381.4E-1372136IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.71474137IPR004827Basic-leucine zipper domain
PfamPF001702.2E-1276134IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.78E-1176126No hitNo description
CDDcd147025.92E-1477128No hitNo description
PROSITE patternPS0003607994IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MPIAMNICKI EEDNHKAFSI QNPLFPSNFS LNFDNLTCNQ TFLDVEEINF GAQYLSYISS  60
TSNEAEEQPK NQVDERKHRR MLSNRESARR SRMRKKRQIN ELWSHVLRLR TENHALIDKL  120
EHVSESHNQV LQENIQLKEE TSNLRQMLTY MKLDTNDVLY NALRYVEDN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681298.11e-123PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC23e-34BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0J8C9021e-123A0A0J8C902_BETVU; Uncharacterized protein
STRINGGLYMA02G13960.28e-41(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-37basic leucine-zipper 42